TMEM135 Rabbit Polyclonal Antibody

CAT#: TA338629

Rabbit Polyclonal Anti-TMEM135 Antibody

Product Images

WB Suggested Anti-TMEM135 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM135 antibody: synthetic peptide directed towards the N terminal of human TMEM135. Synthetic peptide located within the following region: SLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFLTANGALYMAFFC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: transmembrane protein 135
• Database Link:
  NP_075069
  Entrez Gene 65084 Human
  UniProt ID Q86UB9
• Background: The exact function of TMEM135 remains unknown.
• Synonyms: PMP52
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 86%; Mouse: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transmembrane