Antibodies

View as table Download

TMPRSS5 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 6-35 amino acids from the N-terminal region of human TMPRSS5

Goat Polyclonal Antibody against TMPRSS5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-LDWIHDTAQDSLL, from the C Terminus of the protein sequence according to NP_110397.1.

Rabbit Polyclonal Anti-TMPRSS5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMPRSS5 antibody: synthetic peptide directed towards the middle region of human TMPRSS5. Synthetic peptide located within the following region: SWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALN

Carrier-free (BSA/glycerol-free) TMPRSS5 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TMPRSS5 mouse monoclonal antibody, clone OTI6E11 (formerly 6E11)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TMPRSS5 mouse monoclonal antibody, clone OTI6G10 (formerly 6G10)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TMPRSS5 mouse monoclonal antibody, clone OTI7C3 (formerly 7C3)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TMPRSS5 mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-TMPRSS5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TMPRSS5

TMPRSS5 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TMPRSS5

TMPRSS5 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

TMPRSS5 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

TMPRSS5 mouse monoclonal antibody, clone OTI6E11 (formerly 6E11)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

TMPRSS5 mouse monoclonal antibody, clone OTI6E11 (formerly 6E11)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

TMPRSS5 mouse monoclonal antibody, clone OTI6G10 (formerly 6G10)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

TMPRSS5 mouse monoclonal antibody, clone OTI6G10 (formerly 6G10)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

TMPRSS5 mouse monoclonal antibody, clone OTI7C3 (formerly 7C3)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

TMPRSS5 mouse monoclonal antibody, clone OTI7C3 (formerly 7C3)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

TMPRSS5 mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

TMPRSS5 mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated