Germany
Japan
United Kingdom
China
TMPRSS5 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 6-35 amino acids from the N-terminal region of human TMPRSS5 |
Antibodies
View as table Download
Goat Polyclonal Antibody against TMPRSS5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-LDWIHDTAQDSLL, from the C Terminus of the protein sequence according to NP_110397.1. |
Rabbit Polyclonal Anti-TMPRSS5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS5 antibody: synthetic peptide directed towards the middle region of human TMPRSS5. Synthetic peptide located within the following region: SWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALN |
TMPRSS5 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
TMPRSS5 mouse monoclonal antibody, clone OTI6E11 (formerly 6E11)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
TMPRSS5 mouse monoclonal antibody, clone OTI6G10 (formerly 6G10)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
TMPRSS5 mouse monoclonal antibody, clone OTI7C3 (formerly 7C3)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
TMPRSS5 mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
Active filters
Target Symbol
- TMPRSS5