Rabbit Polyclonal Anti-TNKS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNKS antibody: synthetic peptide directed towards the middle region of human TNKS. Synthetic peptide located within the following region: VSASLISPASTPSCLSAASSIDNLTGPLAELAVGGASNAGDGAAGTERKE |
Rabbit Polyclonal Anti-TNKS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNKS antibody: synthetic peptide directed towards the middle region of human TNKS. Synthetic peptide located within the following region: LIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQST |
Tankyrase (TNKS) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 54-82 amino acids from the N-terminal region of human TNKS |
Goat Anti-Tankyrase / TANK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein containing 120aa amino acids from N Terminal regionof the protein sequence according to NP_003738.2.No cross reactivity expected to TANK2. |
TNKS Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1050-1150 of human TNKS (NP_003738.2). |
Germany
Japan
United Kingdom
China
