Tankyrase (TNKS) Rabbit Polyclonal Antibody

CAT#: TA334260

Rabbit Polyclonal Anti-TNKS Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TNKS"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TNKS antibody: synthetic peptide directed towards the middle region of human TNKS. Synthetic peptide located within the following region: LIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQST
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 142 kDa
Gene Name tankyrase
Background TNKS may regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. It has PARP activity and can modify TERF1, and thereby contribute to the regulation of telomere length.
Synonyms ARTD5; PARP-5a; PARP5A; PARPL; pART5; TIN1; TINF1; TNKS1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.