Antibodies

View as table Download

Rabbit Polyclonal Anti-TPD52 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TPD52 antibody: synthetic peptide directed towards the C terminal of human TPD52. Synthetic peptide located within the following region: RELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDV

Rabbit Polyclonal Anti-TPD52 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TPD52 antibody: synthetic peptide directed towards the middle region of human TPD52. Synthetic peptide located within the following region: AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAG

Goat Polyclonal Antibody against TPD52

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TEPLPEKTQES, from the C Terminus of the protein sequence according to NP_001020423.1 ; NP_001020424.1; NP_005070.1.

Rabbit polyclonal anti-TPD52 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TPD52.

Rabbit anti Tpd52 (Tumor Protein D52) Polyclonal Antibody

Applications WB
Reactivities Bovine, Chicken, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the internal sequence of tumor protein D52 (Tpd52). This sequence is identical to mouse, rat, human, chicken and bovine origins.

Rabbit Polyclonal Anti-TPD52 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TPD52

TPD52 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human TPD52 (NP_005070.1).
Modifications Unmodified