Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-TPRA1 (GPR175) antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR175. |
Antibodies
View as table Download
Rabbit polyclonal anti-TPRA1 (GPR175) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR175. |
Rabbit Polyclonal Anti-TPRA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TPRA1 Antibody is: synthetic peptide directed towards the C-terminal region of Human TPRA1. Synthetic peptide located within the following region: SFFAPLIYVAFLRGFFGSEPKILFSYKCQVDETEEPDVHLPQPYAVARRE |
Active filters
Target Symbol
- TPRA1