TPRA1 Rabbit Polyclonal Antibody

CAT#: TA334080

Rabbit Polyclonal Anti-TPRA1 Antibody

Product Images

Host: Rabbit; Target Name: TPRA1; Sample Tissue: HCT15 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml.TPRA1 is supported by BioGPS gene expression data to be expressed in HCT15

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TPRA1 Antibody is: synthetic peptide directed towards the C-terminal region of Human TPRA1. Synthetic peptide located within the following region: SFFAPLIYVAFLRGFFGSEPKILFSYKCQVDETEEPDVHLPQPYAVARRE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: transmembrane protein adipocyte associated 1
• Database Link:
  NP_001129525
  Entrez Gene 131601 Human
  UniProt ID Q86W33
• Background: The function of this protein remains unknown.
• Synonyms: GPR175; TMEM227; TPRA40
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Pig: 86%; Rat: 86%; Mouse: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane