Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-TRAFD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRAFD1 antibody: synthetic peptide directed towards the C terminal of human TRAFD1. Synthetic peptide located within the following region: TATNHVTEGIPRLDSQPQETSPELPRRRVRHQGDLSSGYLDDTKQETANG |
Carrier-free (BSA/glycerol-free) TRAFD1 mouse monoclonal antibody,clone OTI3E8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TRAFD1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TRAFD1 |
TRAFD1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human TRAFD1 (NP_006691.1). |
| Modifications | Unmodified |
TRAFD1 mouse monoclonal antibody,clone OTI3E8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TRAFD1 mouse monoclonal antibody,clone OTI3E8, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
TRAFD1 mouse monoclonal antibody,clone OTI3E8, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TRAFD1 mouse monoclonal antibody,clone OTI3E8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- TRAFD1