TRAFD1 Rabbit Polyclonal Antibody

CAT#: TA331183

Rabbit Polyclonal Anti-TRAFD1 Antibody

Product Images

WB Suggested Anti-TRAFD1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Raji cell lysateTRAFD1 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRAFD1 antibody: synthetic peptide directed towards the C terminal of human TRAFD1. Synthetic peptide located within the following region: TATNHVTEGIPRLDSQPQETSPELPRRRVRHQGDLSSGYLDDTKQETANG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: TRAF-type zinc finger domain containing 1
• Database Link:
  NP_006691
  Entrez Gene 10906 Human
  UniProt ID O14545
• Background: TRAFD1 is a new candidate transcription factor.
• Synonyms: FLN29
• Note: Human: 100%; Pig: 93%; Guinea pig: 93%; Dog: 86%; Rat: 86%; Horse: 86%; Rabbit: 86%; Mouse: 85%; Bovine: 79%