Antibodies

View as table Download

Rabbit Polyclonal Anti-TRAPPC6B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRAPPC6B antibody: synthetic peptide directed towards the middle region of human TRAPPC6B. Synthetic peptide located within the following region: TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF

TRAPPC6B Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human TRAPPC6B (NP_803235.1).
Modifications Unmodified