TRAPPC6B Rabbit Polyclonal Antibody

CAT#: TA337567

Rabbit Polyclonal Anti-TRAPPC6B Antibody

Product Images

WB Suggested Anti-TRAPPC6B Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRAPPC6B antibody: synthetic peptide directed towards the middle region of human TRAPPC6B. Synthetic peptide located within the following region: TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: trafficking protein particle complex 6B
• Database Link:
  NP_803235
  Entrez Gene 122553 Human
  UniProt ID Q86SZ2
• Background: TRAPPC6B is a component of TRAPP complexes, which are tethering complexes involved in vesicle transport.TRAPPC6B is a component of TRAPP complexes, which are tethering complexes involved in vesicle transport (Kummel et al., 2005 [PubMed 16025134]). [supplied by OMIM]
• Synonyms: TPC6
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 92%; Yeast: 92%