Rabbit Polyclonal Anti-TRIM45 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM45 antibody: synthetic peptide directed towards the middle region of human TRIM45. Synthetic peptide located within the following region: EVDPAKCVLQGEDLHRAREKQTASFTLLCKDAAGEIMGRGGDNVQVAVVP |
Rabbit Polyclonal Anti-TRIM45 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM45 antibody: synthetic peptide directed towards the N terminal of human TRIM45. Synthetic peptide located within the following region: FKAPRLLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRS |
Carrier-free (BSA/glycerol-free) TRIM45 mouse monoclonal antibody,clone OTI2D7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TRIM45 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-400 of human TRIM45 (NP_001139107.1). |
| Modifications | Unmodified |
TRIM45 mouse monoclonal antibody,clone OTI2D7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
TRIM45 mouse monoclonal antibody,clone 2D7, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
TRIM45 mouse monoclonal antibody,clone 2D7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
TRIM45 mouse monoclonal antibody,clone OTI2D7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
USD 420.00
5 Days
USD 420.00
5 Days
Germany
Japan
United Kingdom
China
