TRIM45 Rabbit Polyclonal Antibody

CAT#: TA330473

Rabbit Polyclonal Anti-TRIM45 Antibody

Product Images

WB Suggested Anti-TRIM45 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIM45 antibody: synthetic peptide directed towards the N terminal of human TRIM45. Synthetic peptide located within the following region: FKAPRLLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: tripartite motif containing 45
• Database Link:
  NP_079464
  Entrez Gene 80263 Human
  UniProt ID Q9H8W5
• Background: TRIM45 is a member of the tripartite motif family. It may function as a transcriptional repressor of the mitogen-activated protein kinase pathway. Alternatively spliced transcript variants have been described. TRIM45 belongs to a family of tripartite motif (TRIM) proteins that play important roles in a variety of cellular functions, including cell proliferation, differentiation, development, oncogenesis, and apoptosis (Wang et al., 2004 [PubMed 15351693]). [supplied by OMIM]
• Synonyms: RNF99
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 93%