Antibodies

Jump to Filters
View as table Download
TRNT1 Rabbit Polyclonal Antibody
TA343834

USD 410.00

5 Days

Rabbit Polyclonal Anti-TRNT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRNT1 antibody: synthetic peptide directed towards the N terminal of human TRNT1. Synthetic peptide located within the following region: PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT
TRNT1 Rabbit Polyclonal Antibody
TA382857

USD 220.00

3 Weeks

TRNT1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 135-434 of human TRNT1 (NP_886552.2).
Modifications Unmodified