Antibodies

Jump to Filters
View as table Download
TSC22 domain family, member 4 (TSC22D4) Rabbit Polyclonal Antibody
TA329117

USD 310.00

5 Days

Rabbit Polyclonal anti-TSC22D4 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TSC22D4 antibody: synthetic peptide directed towards the N terminal of human TSC22D4. Synthetic peptide located within the following region: SGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPPTGPPPRLPNGEPSPD
Tsc22d4 Rabbit Polyclonal Antibody
TA329926

USD 310.00

5 Days

Rabbit Polyclonal Anti-Tsc22d4 Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Tsc22d4 antibody: synthetic peptide directed towards the N terminal of mouse Tsc22d4. Synthetic peptide located within the following region: GSPGASDSPVPPALAGPPPRLPNGDPNPDPGGRGTPRNGSPPPGAPASRF
Tsc22d4 Rabbit Polyclonal Antibody
TA329118

USD 375.00

5 Days

Rabbit Polyclonal anti-Tsc22d4 Antibody

Applications WB
Reactivities Rat
Immunogen The immunogen for Anti-Tsc22d4 antibody is: synthetic peptide directed towards the N-terminal region of Rat Tsc22d4. Synthetic peptide located within the following region: PAPPAPAGPPPRLPNGEPNPDPGGRGTPRNGSPPPGAPASRFRVVKLPQG
Tsc22d4 Rabbit Polyclonal Antibody
TA329927

USD 375.00

5 Days

Rabbit Polyclonal Anti-Tsc22d4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Tsc22d4 antibody: synthetic peptide directed towards the middle region of mouse Tsc22d4. Synthetic peptide located within the following region: VAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSML