Antibodies

Jump to Filters
View as table Download
TSKS Rabbit Polyclonal Antibody
TA335489

USD 375.00

5 Days

Rabbit Polyclonal Anti-TSKS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TSKS Antibody: synthetic peptide directed towards the N terminal of human TSKS. Synthetic peptide located within the following region: MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKK
TSKS Rabbit Polyclonal Antibody
TA335490

USD 375.00

5 Days

Rabbit Polyclonal Anti-TSKS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TSKS Antibody: synthetic peptide directed towards the middle region of human TSKS. Synthetic peptide located within the following region: ALRLLGGLGGRVDGFLGQWERAQREQAQTARDLQELRGRADELCTMVERS