TSKS Rabbit Polyclonal Antibody

CAT#: TA335489

Rabbit Polyclonal Anti-TSKS Antibody

Product Images

WB Suggested Anti-TSKS Antibody Titration: 1 ug/ml; Positive Control: HepG2 cell lysate

• 

  Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0 ug/ml using anti-TSKS antibody

• 

  Human Testis

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TSKS Antibody: synthetic peptide directed towards the N terminal of human TSKS. Synthetic peptide located within the following region: MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: testis specific serine kinase substrate
• Database Link:
  NP_068379
  Entrez Gene 60385 Human
  UniProt ID Q9UJT2
• Background: TSKS may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of TSKS is highest in the testis and down-regulated in testicular cancer. The gene is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression.This gene may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of the encoded protein is highest in the testis and down-regulated in testicular cancer. The gene is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression.
• Synonyms: PPP1R161; STK22S1; TSKS1; TSSKS
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome