Rabbit Polyclonal Anti-TAL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAL2 antibody: synthetic peptide directed towards the middle region of human TAL2. Synthetic peptide located within the following region: LGEQSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHI |
Rabbit Polyclonal Anti-Tal2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tal2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: INFLVKVLGEQSLHQTGVAAQGNILGLFPPKTRLPDEDDRTLLNDYRVPS |
Rabbit Polyclonal Anti-TAL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAL2 antibody: synthetic peptide directed towards the N terminal of human TAL2. Synthetic peptide located within the following region: TRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYI |
TAL2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human TAL2 (NP_005412.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China