Rabbit Polyclonal Anti-TCEA2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCEA2 antibody: synthetic peptide directed towards the N terminal of human TCEA2. Synthetic peptide located within the following region: SLIKSWKKLLDASDAKARERGRGMPLPTSSRDASEAPDPSRKRPELPRAP |
Rabbit Polyclonal Anti-TCEA2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCEA2 antibody: synthetic peptide directed towards the N terminal of human TCEA2. Synthetic peptide located within the following region: SLIKSWKKLLDASDAKARERGRGMPLPTSSRDASEAPDPSRKRPELPRAP |
TFIIS (TCEA2) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 85-115 amino acids from the Central region of human TCEA2 |
Rabbit Polyclonal Anti-TCEA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCEA2 Antibody: synthetic peptide directed towards the N terminal of human TCEA2. Synthetic peptide located within the following region: QSTRVGMSVNALRKQSSDEEVIALAKSLIKSWKKLLDASDAKARERGRGM |
Rabbit Polyclonal Anti-Tcea2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Tcea2 antibody is: synthetic peptide directed towards the middle region of Rat Tcea2. Synthetic peptide located within the following region: SVNALRKQSSDEELIALAKSLIKSWKKLLDVSDGKSRDQGRGTPLPTSSS |
Rabbit Polyclonal Anti-Tcea2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tcea2 antibody: synthetic peptide directed towards the middle region of mouse Tcea2. Synthetic peptide located within the following region: KDASRTTDLSCKKPDPPRTPSTPRITTFPQVPITCDAVRNKCREMLTLAL |
Germany
Japan
United Kingdom
China