Tcea2 Rabbit Polyclonal Antibody

CAT#: TA341818

Rabbit Polyclonal Anti-Tcea2 Antibody

Product Images

WB Suggested Anti-Tcea2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Uterus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Tcea2 antibody: synthetic peptide directed towards the middle region of mouse Tcea2. Synthetic peptide located within the following region: KDASRTTDLSCKKPDPPRTPSTPRITTFPQVPITCDAVRNKCREMLTLAL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34
• Gene Name: transcription elongation factor A (SII), 2
• Database Link:
  NP_033352
  Entrez Gene 21400 Mouse
  UniProt ID Q9QVN7
• Background: Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites.The arresting sites in DNA haveThe property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage ofThe nascent transcript by S-II allowsThe resumption of elongation fromThe new 3'-terminus.
• Synonyms: OTTHUMP00000031638; TFIIS
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Horse: 79%