Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-TCFL5 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TCFL5. |
Antibodies
View as table Download
Rabbit Polyclonal anti-TCFL5 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCFL5 antibody: synthetic peptide directed towards the middle region of human TCFL5. Synthetic peptide located within the following region: TLIRHPSELMNVPLQQQNKCTALVKNKTAATTTALQFTYPLFTTNACSTS |
Goat Polyclonal Antibody against TCFL5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KYIQERHGDSLKKE, from the internal region of the protein sequence according to NP_006593.2. |
Rabbit polyclonal anti-Tcfl5 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for Anti-Tcfl5 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tcfl5. Synthetic peptide located within the following region: EKTPGGADGTRTRADGVAKEGAGGAGPDGAPEARAKPTVRVRLEDRFNSM |
Active filters
Target Symbol
- TCFL5