Rabbit Polyclonal Anti-TFDP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TFDP2 Antibody: synthetic peptide directed towards the N terminal of human TFDP2. Synthetic peptide located within the following region: MIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKF |
Rabbit Polyclonal anti-TFDP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TFDP2 antibody is: synthetic peptide directed towards the C-terminal region of Human TFDP2. Synthetic peptide located within the following region: SVNQGLCLDAEVALATGQFLAPNSHQSSSAASHCSESRGETPCSFNDEDE |
Rabbit polyclonal anti-Tfdp2 antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for anti-Tfdp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GLLLNSTQSVSNLDPTTGATVPQSSVNQGLCLDAEVALATGQLPASNSHQ |
Rabbit polyclonal anti-Tfdp2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for Anti-Tfdp2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Tfdp2. Synthetic peptide located within the following region: IDSDFSESKRSKKGDKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSE |
Carrier-free (BSA/glycerol-free) TFDP2 mouse monoclonal antibody,clone OTI4C11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TFDP2 mouse monoclonal antibody,clone OTI7B6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TFDP2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
TFDP2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
TFDP2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 287-386 of human TFDP2 (NP_006277.1). |
| Modifications | Unmodified |
TFDP2 mouse monoclonal antibody,clone OTI4C11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TFDP2 mouse monoclonal antibody,clone OTI4C11, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
TFDP2 mouse monoclonal antibody,clone OTI4C11, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
TFDP2 mouse monoclonal antibody,clone OTI4C11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TFDP2 mouse monoclonal antibody,clone OTI7B6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TFDP2 mouse monoclonal antibody,clone OTI7B6, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
TFDP2 mouse monoclonal antibody,clone OTI7B6, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
TFDP2 mouse monoclonal antibody,clone OTI7B6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
