Antibodies

View as table Download

Rabbit Polyclonal TGIF Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

TGIF (TGIF1) (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 215-245 amino acids from the Central region of human TGIF1

TGIF (TGIF1) (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 152-182 amino acids from the Central region of human TGIF1

Rabbit Polyclonal Anti-TGIF1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TGIF1 antibody: synthetic peptide directed towards the C terminal of human TGIF1. Synthetic peptide located within the following region: GQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLN

Carrier-free (BSA/glycerol-free) TGIF1 mouse monoclonal antibody, clone OTI1G5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TGIF1 mouse monoclonal antibody, clone OTI4D10 (formerly 4D10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TGIF1 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TGIF1 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TGIF1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TGIF1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TGIF1 mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TGIF1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 123-272 of human TGIF1 (NP_003235.1).

TGIF1 mouse monoclonal antibody, clone OTI1G5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TGIF1 mouse monoclonal antibody, clone OTI4D10 (formerly 4D10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TGIF1 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TGIF1 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

TGIF1 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TGIF1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TGIF1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

TGIF1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TGIF1 mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TGIF1 mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".