Antibodies

Jump to Filters
View as table Download
TIMM10 Rabbit Polyclonal Antibody
TA331993

USD 375.00

5 Days

Rabbit Polyclonal Anti-TIMM10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TIMM10 Antibody is: synthetic peptide directed towards the middle region of Human TIMM10. Synthetic peptide located within the following region: AELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA
TIMM10 Rabbit Polyclonal Antibody
TA382532

USD 220.00

3 Weeks

TIMM10 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human TIMM10 (NP_036588.1).
Modifications Unmodified