TIMM10 Rabbit Polyclonal Antibody

CAT#: TA331993

Rabbit Polyclonal Anti-TIMM10 Antibody

Product Images

Host: Rabbit; Target Name: TIMM10; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/ml; TIMM10 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TIMM10 Antibody is: synthetic peptide directed towards the middle region of Human TIMM10. Synthetic peptide located within the following region: AELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 9 kDa
• Gene Name: translocase of inner mitochondrial membrane 10 homolog (yeast)
• Database Link:
  NP_036588
  Entrez Gene 26519 Human
  UniProt ID P62072
• Background: The mitochondrial protein encoded by this gene belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane, functioning as intermembrane space chaperones for the highly insoluble carrier proteins.
• Synonyms: TIM10; TIM10A; TIMM10A
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 92%