Antibodies

Jump to Filters
View as table Download
TIMM50 Goat Polyclonal Antibody
TA302964

USD 375.00

5 Days

Goat Polyclonal Antibody against TIMM50

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CDVRTVLEHYALEDD, from the internal region of the protein sequence according to NP_001001563.
TIMM50 Rabbit Polyclonal Antibody
TA334156

USD 375.00

5 Days

Rabbit Polyclonal Anti-TIMM50 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TIMM50 Antibody is: synthetic peptide directed towards the C-terminal region of Human TIMM50. Synthetic peptide located within the following region: EDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP
TIMM50 Mouse Monoclonal Antibody [Clone ID: OTI1E9]
CF811603

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TIMM50 mouse monoclonal antibody,clone OTI1E9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TIMM50 Rabbit Polyclonal Antibody
TA382539

USD 220.00

3 Weeks

TIMM50 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 190-456 of human TIMM50 (NP_001001563.1).
Modifications Unmodified
TIMM50 Mouse Monoclonal Antibody [Clone ID: OTI1E9]
TA811603

USD 379.00

In Stock

TIMM50 mouse monoclonal antibody,clone OTI1E9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TIMM50 Mouse Monoclonal Antibody [Clone ID: OTI1E9]
TA811603S

USD 159.00

2 Days

TIMM50 mouse monoclonal antibody,clone OTI1E9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated