TIMM50 Rabbit Polyclonal Antibody

CAT#: TA334156

Rabbit Polyclonal Anti-TIMM50 Antibody

Product Images

Host: Rabbit; Target Name: TIMM50; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TIMM50 Antibody is: synthetic peptide directed towards the C-terminal region of Human TIMM50. Synthetic peptide located within the following region: EDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: translocase of inner mitochondrial membrane 50
• Database Link:
  NP_001001563
  Entrez Gene 92609 Human
  UniProt ID Q3ZCQ8
• Background: The function of this protein remains unknown.
• Synonyms: TIM50; TIM50L
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 75%