Rabbit Polyclonal Anti-TIPIN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TIPIN antibody: synthetic peptide directed towards the N terminal of human TIPIN. Synthetic peptide located within the following region: MLEPQENGVIDLPDYEHVEDETFPPFPPPASPERQDGEGTEPDEESGNGA |
Rabbit Polyclonal Anti-TIPIN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TIPIN antibody: synthetic peptide directed towards the middle region of human TIPIN. Synthetic peptide located within the following region: SESEMFASELSRSLTEEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLM |
Carrier-free (BSA/glycerol-free) TIPIN mouse monoclonal antibody, clone OTI2E2 (formerly 2E2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TIPIN mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TIPIN mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TIPIN mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TIPIN Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-301 of human TIPIN (NP_060328.2). |
| Modifications | Unmodified |
TIPIN mouse monoclonal antibody, clone OTI2E2 (formerly 2E2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TIPIN mouse monoclonal antibody,clone 2E2, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
TIPIN mouse monoclonal antibody,clone 2E2, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TIPIN mouse monoclonal antibody, clone OTI2E2 (formerly 2E2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
5 Days
TIPIN mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
TIPIN mouse monoclonal antibody,clone 3B11, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
TIPIN mouse monoclonal antibody,clone 3B11, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TIPIN mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TIPIN mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TIPIN mouse monoclonal antibody,clone 1A3, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
TIPIN mouse monoclonal antibody,clone 1A3, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TIPIN mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TIPIN mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
TIPIN mouse monoclonal antibody,clone 1E11, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
TIPIN mouse monoclonal antibody,clone 1E11, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TIPIN mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
