Antibodies

Jump to Filters
View as table Download
TLX3 Rabbit Polyclonal Antibody
TA590472

USD 409.00

In Stock

Rabbit Polyclonal TLX3 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
TLX3 Rabbit Polyclonal Antibody
TA319908

USD 430.00

5 Days

Rabbit Polyclonal TLX3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TLX3 antibody was raised against a 16 amino acid peptide near the amino terminus of human TLX3.
TLX3 Rabbit Polyclonal Antibody
TA329697

USD 375.00

5 Days

Rabbit Polyclonal Anti-TLX3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLX3 antibody: synthetic peptide directed towards the N terminal of human TLX3. Synthetic peptide located within the following region: MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGG