TLX3 Rabbit Polyclonal Antibody

CAT#: TA329697

Rabbit Polyclonal Anti-TLX3 Antibody

Product Images

WB Suggested Anti-TLX3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: ACHN cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TLX3 antibody: synthetic peptide directed towards the N terminal of human TLX3. Synthetic peptide located within the following region: MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: T-cell leukemia homeobox 3
• Database Link:
  NP_066305
  Entrez Gene 30012 Human
  UniProt ID O43711
• Background: RNX (HOX11L2, TLX3) belongs to a family of orphan homeobox genes that encode DNA-binding nuclear transcription factors. Members of the HOX11 gene family are characterized by a threonine-47 replacing cytosine in the highly conserved homeodomain.
• Synonyms: HOX11L2; RNX
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%

Reference Data

• Protein Families: Transcription Factors