Rabbit Polyclonal Anti-TMF1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMF1 antibody: synthetic peptide directed towards the N terminal of human TMF1. Synthetic peptide located within the following region: TPETTESQVKDSSLCVSGETLAAGTSSPKTEGKHEETVNKESDMKVPTVS |
Rabbit Polyclonal Anti-TMF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMF1 antibody: synthetic peptide directed towards the middle region of human TMF1. Synthetic peptide located within the following region: GNLEKTRSIMAEELVKLTNQNDELEEKVKEIPKLRTQLRDLDQRYNTILQ |
TMF1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human TMF1 (NP_009045.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China