TATA Element Modulatory Factor 1 (TMF1) Rabbit Polyclonal Antibody

CAT#: TA344464

Rabbit Polyclonal Anti-TMF1 Antibody - N-terminal region

Product Images

WB Suggested Anti-TMF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: MCF7 cell lysateThere is BioGPS gene expression data showing that TMF1 is expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMF1 antibody: synthetic peptide directed towards the N terminal of human TMF1. Synthetic peptide located within the following region: TPETTESQVKDSSLCVSGETLAAGTSSPKTEGKHEETVNKESDMKVPTVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 123 kDa
• Gene Name: TATA element modulatory factor 1
• Database Link:
  NP_009045
  Entrez Gene 7110 Human
  UniProt ID P82094
• Background: TMF1 binds the HIV-1 TATA element and inhibits transcriptional activation by the TATA-binding protein (TBP).
• Synonyms: ARA160; TMF
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Dog: 86%; Bovine: 86%; Rat: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Transcription Factors