Rabbit Polyclonal Anti-TMOD4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TMOD4 antibody is: synthetic peptide directed towards the middle region of Human TMOD4. Synthetic peptide located within the following region: CNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVRSNDKELEEVNLNNI |
Rabbit Polyclonal Anti-TMOD4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TMOD4 antibody is: synthetic peptide directed towards the N-terminal region of Human TMOD4. Synthetic peptide located within the following region: PEELEQLDCELQEMDPENMLLPAGLRQRDQTKKSPTGPLDREALLQYLEQ |
TMOD4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-345 of human TMOD4 (NP_037485.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China