Germany
Japan
United Kingdom
China
Goat Anti-TMPRSS4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DSTRCNADDAYQGE, from the internal region of the protein sequence according to NP_063947.1; NP_001077416.1. |
Antibodies
View as table Download
Goat Anti-TMPRSS4 (aa245-57) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence HCFRKHTDVFNWK, from the internal region of the protein sequence according to NP_063947.1; NP_001077416.1. |
Rabbit polyclonal Anti-TMPRSS4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS4 antibody: synthetic peptide directed towards the N terminal of human TMPRSS4. Synthetic peptide located within the following region: IPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSAT |
Rabbit polyclonal Anti-TMPRSS4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS4 antibody: synthetic peptide directed towards the middle region of human TMPRSS4. Synthetic peptide located within the following region: LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS |
Rabbit Polyclonal Anti-TMPRSS4 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TMPRSS4 antibody was raised against synthetic 19 amino acid peptide from internal region of human TMPRSS4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gibbon, Monkey, Marmoset (100%); Gorilla, Orangutan (95%); Dog, Horse (89%); Hamster, Elephant, Panda, Pig (84%). |
Rabbit Polyclonal Anti-TMPRSS4 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | TMPRSS4 antibody was raised against synthetic 18 amino acid peptide from N-Terminus of human TMPRSS4. Percent identity with other species by BLAST analysis: Human (100%); Chimpanzee, Orangutan, Gibbon (94%); Gorilla, Monkey (89%); Marmoset, Dog (83%). |
Rabbit Polyclonal Anti-TMPRSS4 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | TMPRSS4 antibody was raised against synthetic 16 amino acid peptide from internal region of human TMPRSS4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Marmoset (100%); Mouse, Guinea pig (94%); Rat, Elephant, Panda, Bovine, Horse, Rabbit, Pig, Opossum (88%); Galago, Hamster, Dog, Platypus (81%). |
Rabbit Polyclonal Anti-TMPRSS4 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TMPRSS4 antibody was raised against synthetic 19 amino acid peptide from internal region of human TMPRSS4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Elephant (95%); Panda, Dog, Horse, Pig (89%). |
Rabbit Polyclonal Anti-TMPRSS4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TMPRSS4 |
TMPRSS4 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TMPRSS4 |
TMPRSS4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 70-270 of human TMPRSS4 (NP_063947.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TMPRSS4