Antibodies

Jump to Filters
View as table Download
TNKS1BP1 Rabbit Polyclonal Antibody
TA344370

USD 475.00

5 Days

Rabbit Polyclonal Anti-TNKS1BP1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNKS1BP1 antibody: synthetic peptide directed towards the middle region of human TNKS1BP1. Synthetic peptide located within the following region: DGEASQTEDVDGTWGSSAARWSDQGPAQTSRRPSQGPPARSPSQDFSFIE