Antibodies

Jump to Filters
View as table Download
Transition Protein 1 (TNP1) Rabbit Polyclonal Antibody
TA335779

USD 375.00

5 Days

Rabbit Polyclonal Anti-TNP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TNP1 Antibody: synthetic peptide directed towards the N terminal of human TNP1. Synthetic peptide located within the following region: MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRN