Transition Protein 1 (TNP1) Rabbit Polyclonal Antibody

CAT#: TA335779

Rabbit Polyclonal Anti-TNP1 Antibody

Product Images

WB Suggested Anti-TNP1 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TNP1 Antibody: synthetic peptide directed towards the N terminal of human TNP1. Synthetic peptide located within the following region: MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 6 kDa
• Gene Name: transition protein 1
• Database Link:
  NP_003275
  Entrez Gene 7141 Human
  UniProt ID P09430
• Background: TNP1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines.Transition protein-1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines (see PRM1, MIM 182880; PRM2, MIM 182890) (Luerssen et al., 1990 [PubMed 2249851]). [supplied by OMIM]. Sequence Note: removed 4 bases from the 5' end that did not align to the reference genome assembly. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: TP1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Sheep: 92%; Bovine: 92%; Guinea pig: 92%