Rabbit Polyclonal Anti-TOP1MT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TOP1MT antibody is: synthetic peptide directed towards the C-terminal region of Human TOP1MT. Synthetic peptide located within the following region: KKRRLLEKLQEQLAQLSVQATDKEENKQVALGTSKLNYLDPRISIAWCKR |
Anti-TOP1MT Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 151-165 amino acids of human topoisomerase (DNA) I, mitochondrial |
TOP1MT Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 470-550 of human TOP1MT (NP_443195.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
