Antibodies

Jump to Filters
View as table Download
TOP1MT Rabbit Polyclonal Antibody
TA331301

USD 375.00

5 Days

Rabbit Polyclonal Anti-TOP1MT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TOP1MT antibody is: synthetic peptide directed towards the C-terminal region of Human TOP1MT. Synthetic peptide located within the following region: KKRRLLEKLQEQLAQLSVQATDKEENKQVALGTSKLNYLDPRISIAWCKR
TOP1MT Rabbit Polyclonal Antibody
TA324243

USD 345.00

In Stock

Anti-TOP1MT Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 151-165 amino acids of human topoisomerase (DNA) I, mitochondrial
TOP1MT Rabbit Polyclonal Antibody
TA324244

USD 345.00

In Stock

Anti-TOP1MT Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 151-165 amino acids of human topoisomerase (DNA) I, mitochondrial
TOP1MT Rabbit Polyclonal Antibody
TA382707

USD 275.00

3 Weeks

TOP1MT Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 470-550 of human TOP1MT (NP_443195.1).
Modifications Unmodified