TOP1MT Rabbit Polyclonal Antibody
Other products for "TOP1MT"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-TOP1MT antibody is: synthetic peptide directed towards the C-terminal region of Human TOP1MT. Synthetic peptide located within the following region: KKRRLLEKLQEQLAQLSVQATDKEENKQVALGTSKLNYLDPRISIAWCKR |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 70 kDa |
| Gene Name | topoisomerase (DNA) I, mitochondrial |
| Database Link | |
| Background | This gene encodes a mitochondrial DNA topoisomerase that plays a role in the modification of DNA topology. The encoded protein is a type IB topoisomerase and catalyzes the transient breaking and rejoining of DNA to relieve tension and DNA supercoiling generated in the mitochondrial genome during replication and transcription. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Synonyms | 2900052H09Rik; mitochondrial; mitochondrial topoisomerase I; topoisomerase (DNA) I |
| Note | Rat: 100%; Human: 100%; Mouse: 100%; Pig: 92%; Guinea pig: 92%; Horse: 86%; Dog: 85%; Bovine: 85%; Rabbit: 85%; Zebrafish: 85%; Yeast: 79% |
| Reference Data | |
| Protein Families | Druggable Genome |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China