Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal TPH2(Ser19) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human: Ser19, Mouse: Ser19, Rat: Ser19 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TPH2 around the phosphorylation site of serine 19. |
| Modifications | Phospho-specific |
Rabbit polyclonal TPH2 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TPH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-193 amino acids from the Central region of human TPH2. |
Rabbit Polyclonal Anti-TPH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPH2 antibody: synthetic peptide directed towards the N terminal of human TPH2. Synthetic peptide located within the following region: REAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSS |
Rabbit Anti-Tryptophan Hydroxylase (Ser19) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser19 conjugated to KLH |
| Modifications | Phospho-specific |
Goat Anti-TPH2 (aa16-29) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence RGFSLDSAVPEEHQ-C, from the N Terminus of the protein sequence according to NP_775489.2. |
Rabbit Polyclonal Anti-TPH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPH2 antibody: synthetic peptide directed towards the middle region of human TPH2. Synthetic peptide located within the following region: KMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDA |
Rabbit Polyclonal Tryptophan hydroxylase 2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal portion of the human Tryptophan hydroxylase 2 protein (between residues 1-100) [UniProt Q8IWU9] |
Rabbit Polyclonal Tryptophan hydroxylase 2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal portion of the human Tryptophan hydroxylase 2 protein (between residues 100-200) [UniProt Q8IWU9] |
TPH2 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse TPH2 |
TPH2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TPH2 (NP_775489.2). |
| Modifications | Unmodified |
TPH2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human TPH2 (NP_775489.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TPH2