Rabbit Polyclonal Anti-TRIM39 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM39 antibody: synthetic peptide directed towards the N terminal of human TRIM39. Synthetic peptide located within the following region: HTVVPLDDATQEYKEKLQKCLEPLEQKLQEITRCKSSEEKKPGELKRLVE |
Rabbit Polyclonal Anti-TRIM39 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM39 antibody: synthetic peptide directed towards the middle region of human TRIM39. Synthetic peptide located within the following region: GELKRLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLREN |
TRIM39 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TRIM39 |
TRIM39 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human TRIM39 (NP_067076.2). |
| Modifications | Unmodified |
USD 420.00
5 Days
USD 420.00
5 Days
TRIM39 (RNF23) mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
