Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-TRPM3 (extracellular)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide KNKDDMPYMSQAQEIHC(C), corresponding to amino acid residues 816-831 of human TRPM3. 1st extracellular loop. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-TRPM3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD |
Rabbit Polyclonal Anti-TRPM3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: TPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTY |
Rabbit Polyclonal Anti-TRPM3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: YLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQK |
Rabbit Polyclonal Anti-TRPM3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: RPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISL |
Rabbit Polyclonal Anti-TRPM3 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TRPM3 |
TRPM3 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TRPM3 |
Active filters
Target Symbol
- TRPM3