TRPM3 Rabbit Polyclonal Antibody

CAT#: TA341728

Rabbit Polyclonal Anti-TRPM3 Antibody

Product Images

WB Suggested Anti-TRPM3 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: YLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: transient receptor potential cation channel subfamily M member 3
• Database Link:
  NP_001007471
  Entrez Gene 80036 Human
  UniProt ID Q9HCF6
• Background: This gene encodes a Z-DNA binding protein.The encoded protein plays a role inThe innate immune response by binding to foreign DNA and inducing type-I interferon production. Alternatively spliced transcript variants encoding multiple isoforms have been observed forThis gene. [provided by RefSeq, Dec 2011]
• Synonyms: GON-2; LTRPC3; MLSN2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane