Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to tetraspan 1 (tetraspanin 1)
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 76 and 168 of Tetraspan 1 (Uniprot ID#O60635) |
Rabbit Polyclonal Anti-TSPAN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TSPAN1 Antibody: synthetic peptide directed towards the middle region of human TSPAN1. Synthetic peptide located within the following region: TMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKA |
Recombinant Anti-Tetraspanin 1 (Clone 4/12)
| Applications | ELISA, IF, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-Tetraspanin 1 (Clone 4/12)
| Applications | ELISA, IF, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Active filters
Target Symbol
- TSPAN1