Antibodies

Jump to Filters
View as table Download
TSPAN15 Rabbit Polyclonal Antibody
TA341909

USD 375.00

5 Days

Rabbit Polyclonal Anti-TSPAN15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TSPAN15 antibody: synthetic peptide directed towards the C terminal of human TSPAN15. Synthetic peptide located within the following region: LGILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPSVEAAGTGC
TSPAN15 Rabbit Polyclonal Antibody
TA382899

USD 220.00

3 Weeks

TSPAN15 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 110-220 of human TSPAN15 (NP_036471.1).
Modifications Unmodified