Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-TSPAN8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSPAN8 Antibody: A synthesized peptide derived from human TSPAN8 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-TSPAN8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSPAN8 antibody: synthetic peptide directed towards the middle region of human TSPAN8. Synthetic peptide located within the following region: VFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNG |
Goat Anti-TM4SF3 / TSPAN8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence QRPCQSYNGKQVYKE, from the internal region of the protein sequence according to NP_004607.1. |
TSPAN8 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 110-200 of human TSPAN8 (NP_004607.1). |
| Modifications | Unmodified |
TSPAN8 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 110-200 of human TSPAN8 (NP_004607.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TSPAN8