TM4SF3 (TSPAN8) Rabbit Polyclonal Antibody

CAT#: TA339425

Rabbit Polyclonal Anti-TSPAN8 Antibody

Product Images

WB Suggested Anti-TSPAN8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TSPAN8 antibody: synthetic peptide directed towards the middle region of human TSPAN8. Synthetic peptide located within the following region: VFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: tetraspanin 8
• Database Link:
  NP_004607
  Entrez Gene 7103 Human
  UniProt ID P19075
• Background: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This gene is expressed in different carcinomas. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq, Jul 2008]
• Synonyms: CO-029; TM4SF3
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 82%; Pig: 75%; Guinea pig: 75%

Reference Data

• Protein Families: Transmembrane