Rabbit Polyclonal Anti-U2AF1L4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-U2AF1L4 antibody is: synthetic peptide directed towards the N-terminal region of Human U2AF1L4. Synthetic peptide located within the following region: KIGVCRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQTADGSHCHVSDV |
Goat Anti-U2AF1L4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EDGERAVAELSNR, from the internal region of the protein sequence according to NP_001035515.1 ; NP_659424.2. |
Carrier-free (BSA/glycerol-free) U2AF1L4 mouse monoclonal antibody,clone OTI8F10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) U2AF1L4 mouse monoclonal antibody,clone OTI9C2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) U2AF1L4 mouse monoclonal antibody,clone OTI7B12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) U2AF1L4 mouse monoclonal antibody,clone OTI8B1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
U2AF1L4 mouse monoclonal antibody,clone OTI8F10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
U2AF1L4 mouse monoclonal antibody,clone OTI8F10, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
U2AF1L4 mouse monoclonal antibody,clone OTI8F10, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
U2AF1L4 mouse monoclonal antibody,clone OTI8F10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
U2AF1L4 mouse monoclonal antibody,clone OTI9C2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
U2AF1L4 mouse monoclonal antibody,clone OTI9C2, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
U2AF1L4 mouse monoclonal antibody,clone OTI9C2, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
U2AF1L4 mouse monoclonal antibody,clone OTI9C2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
U2AF1L4 mouse monoclonal antibody,clone OTI7B12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
U2AF1L4 mouse monoclonal antibody,clone OTI7B12, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
U2AF1L4 mouse monoclonal antibody,clone OTI7B12, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
U2AF1L4 mouse monoclonal antibody,clone OTI7B12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
U2AF1L4 mouse monoclonal antibody,clone OTI8B1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
U2AF1L4 mouse monoclonal antibody,clone OTI8B1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
U2AF1L4 mouse monoclonal antibody,clone OTI8B1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
U2AF1L4 mouse monoclonal antibody,clone OTI8B1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China