U2AF1L3 (U2AF1L4) Rabbit Polyclonal Antibody

CAT#: TA345752

Rabbit Polyclonal Anti-U2AF1L4 Antibody

Product Images

Host: Rabbit; Target Name: U2AF1L4; Sample Tissue: HepG2 Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-U2AF1L4 antibody is: synthetic peptide directed towards the N-terminal region of Human U2AF1L4. Synthetic peptide located within the following region: KIGVCRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQTADGSHCHVSDV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: U2 small nuclear RNA auxiliary factor 1-like 4
• Database Link:
  NP_001035515
  Entrez Gene 199746 Human
  UniProt ID Q8WU68
• Background: U2AF1L4 is a RNA-binding protein that function as a pre-mRNA splicing factor. It plays a critical role in both constitutive and enhancer-dependent splicing by mediating protein-protein interactions and protein-RNA interactions required for accurate 3'-splice site selection. It acts by enhancing the binding of U2AF2 to weak pyrimidine tracts and also participates in the regulation of alternative pre-mRNA splicing. It activates exon 5 skipping of PTPRC during T-cell activation; an event reversed by GFI1. U2AF1L4 binds to RNA at the AG dinucleotide at the 3'-splice site.
• Synonyms: U2AF1-RS3; U2AF1L3; U2AF1L3V1; U2AF1RS3; U2af26
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 79%