Antibodies

Jump to Filters
View as table Download
UNC50 Rabbit Polyclonal Antibody
TA341928

USD 375.00

5 Days

Rabbit Polyclonal Anti-UNC50 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UNC50 antibody: synthetic peptide directed towards the N terminal of human UNC50. Synthetic peptide located within the following region: LPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAW
UNC50 Rabbit Polyclonal Antibody
TA383104

USD 220.00

3 Weeks

UNC50 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UNC50 (NP_054763.2).
Modifications Unmodified